PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00039.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 394aa    MW: 42613.8 Da    PI: 8.352
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00039.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.7e-3969128362
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  Rsa1.0_00039.1_g00013.1  69 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 128
                              6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3557122IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3270126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.76172126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MGLTSLQVCM DSDWLQEAES GGSMLDSTTT SPSAADILAA CSTQPQVSAV AVAAAAMMDG  60
GRRLRPPHDH PQKCPRCEST HTKFCYYNNY SLSQPRYFCK TCRRYWTKGG TLRNIPVGGG  120
CRKNKKPSSS NTSSSKKPSS DLMALAHSHQ NYQNASLGFS HFGGNGMMGS YTAPDHSNVG  180
FLESKYGSLF SQSPRPIDFL DGKFDLMGVN NNLVMVDHGS NGDHQHNHHM GLSHGLGLNN  240
NNNGGLMDIS TCQRLILNNY DHHHYNHHED NQRVTSVMDV KPSPKLLSLD WQQEQGYSEG  300
SGNGGGGRSD GSGYGGGGGY INSLAGSTFV SSSMKNNGFS SLKDAVWAAL CYFLGGFILL  360
CMELLVKNRW VKVGLSIAIT SMVIGVAIFS KEKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2289921e-154AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12.
GenBankBT0204671e-154BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankBT0205761e-154BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607164.11e-170PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM031e-146DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A0D3E1Y01e-170A0A0D3E1Y0_BRAOL; Uncharacterized protein
STRINGBra035873.1-P1e-157(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-131Dof family protein